Recombinant Human Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1), partial | CSB-EP021546HU

(No reviews yet) Write a Review
SKU:
CSB-EP021546HU
Availability:
3 - 7 Working Days
$357.60 - $2,042.40

Description

Recombinant Human Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1), partial | CSB-EP021546HU | Cusabio

Alternative Name(s): Glucose transporter type 1, erythrocyte/brain (GLUT-1) (HepG2 glucose transporter)

Gene Names: SLC2A1

Research Areas: Metabolism

Organism: Homo sapiens (Human)

AA Sequence: CPESPRFLLINRNEENRAKSVLKKLRGTADVTHDLQEMKEESRQMMREKKVTILELFRSPAYRQP

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 207-271aa

Sequence Info: partial

MW: 15.2 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Facilitative glucose transporter. This isoform may be responsible for constitutive or basal glucose uptake. Has a very broad substrate specificity; can transport a wide range of aldoses including both pentoses and hexoses.

Reference: "Characterization and expression of human HepG2/erythrocyte glucose-transporter gene." Fukumoto H., Seino S., Imura H., Seino Y., Bell G.I. Diabetes 37:657-661(1988)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P11166

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose