Recombinant Human Sodium/potassium-transporting ATPase subunit gamma (FXYD2) | CSB-EP009090HU

Recombinant Human Sodium/potassium-transporting ATPase subunit gamma (FXYD2) | CSB-EP009090HU | Cusabio

Alternative Name(s): FXYD domain-containing ion transport regulator 2 Sodium pump gamma chain

Gene Names: FXYD2

Research Areas: Neuroscience

Organism: Homo sapiens (Human)

AA Sequence: MDRWYLGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-64aa

Sequence Info: Full Length of Isoform 2

MW: 34.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: May be involved in forming the receptor site for cardiac glycoside binding or may modulate the transport function of the sodium ATPase.

Reference: "Dominant isolated renal magnesium loss is caused by misrouting of the Na+,K+-ATPase gamma-subunit." Meij I.C., Koenderink J.B., van Bokhoven H., Assink K.F.H., Groenestege W.T., de Pont J.J.H.H.M., Bindels R.J.M., Monnens L.A.H., van den Heuvel L.P.W.J., Knoers N.V.A.M. Nat. Genet. 26:265-266(2000)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May be involved in forming the receptor site for cardiac glycoside binding or may modulate the transport function of the sodium ATPase.

Involvement in disease: Hypomagnesemia 2 (HOMG2)

Subcellular Location: Membrane, Single-pass type III membrane protein

Protein Families: FXYD family

Tissue Specificity: Expressed in the distal convoluted tubule in the kidney. Found on basolateral membranes of nephron epithelial cells.

Paythway: cAMPsignalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P54710

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM