Recombinant Human Sodium/glucose cotransporter 2 (SLC5A2), partial | CSB-CF021679HU1

Recombinant Human Sodium/glucose cotransporter 2 (SLC5A2), partial | CSB-CF021679HU1 | Cusabio

Alternative Name(s): Low affinity sodium-glucose cotransporter Solute carrier family 5 member 2

Gene Names: SLC5A2

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: MEEHTEAGSAPEMGAQKALIDNPADILVIAAYFLLVIGVGLWSMCRTNRGTVGGYFLAGRSMVWWPVGASLFASNIGSGHFVGLAGTGAASGLAVAGFEWNA

Source: in vitro E.coli expression system

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Expression Region: 1-102aa

Sequence Info: Partial

MW: 30.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Sodium-dependent glucose transporter. Has a Na+ to glucose coupling ratio of 1:1. Efficient substrate transport in mammalian kidney is provided by the concerted action of a low affinity high capacity and a high affinity low capacity Na+/glucose cotransporter arranged in series along kidney proximal tubules.

Reference: "Novel compound heterozygous mutations in SLC5A2 are responsible for autosomal recessive renal glucosuria." Calado J., Soto K., Clemente C., Correia P., Rueff J. Hum. Genet. 114:314-316(2004)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Sodium-dependent glucose transporter. Has a Na(+) to glucose coupling ratio of 1

Involvement in disease: Renal glucosuria (GLYS)

Subcellular Location: Membrane, Multi-pass membrane protein

Protein Families: Sodium:solute symporter (SSF) (TC 2.A.21) family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P31639

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM