Recombinant Human Small proline-rich protein 2B (SPRR2B) | CSB-YP022613HU

(No reviews yet) Write a Review
SKU:
CSB-YP022613HU
Availability:
25 - 35 Working Days
  • Recombinant Human Small proline-rich protein 2B (SPRR2B)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£271.20 - £1,618.40

Description

Recombinant Human Small proline-rich protein 2B (SPRR2B) | CSB-YP022613HU | Cusabio

Alternative Name(s): SPRR2B; Small proline-rich protein 2B; SPR-2B

Gene Names: SPRR2B

Research Areas: Others

Organism: Homo sapiens (Human)

AA Sequence: MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPSPPCQPKYPPKSK

Source: Yeast

Tag Info: N-terminal 6xHis-tagged and C-terminal Myc-tagged

Expression Region: 1-72aa

Sequence Info: Full Length

MW: 11.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane.

Reference: "Genetic variation in small proline rich protein 2B as a predictor for asthma among children with eczema." Epstein T.G., LeMasters G.K., Bernstein D.I., Ericksen M.B., Martin L.J., Ryan P.H., Biagini Myers J.M., Butsch Kovacic M.S., Lindsey M.A., He H., Reponen T., Villareal M.S., Lockey J.E., Bernstein C.K., Khurana Hershey G.K. Ann. Allergy Asthma Immunol. 108:145-150(2012)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane.

Involvement in disease:

Subcellular Location: Cytoplasm

Protein Families: Cornifin (SPRR) family

Tissue Specificity: Suprabasal layers of squamous-differentiated tissues such as epidermis, esophagus, tongue and trachea.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P35325

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose