Recombinant Human Signal transducer CD24 (CD24) | CSB-RP104644h

(No reviews yet) Write a Review
SKU:
CSB-RP104644h
Availability:
3 - 7 Working Days
  • Recombinant Human Signal transducer CD24 (CD24)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€245.00 - €527.00

Description

Recombinant Human Signal transducer CD24 (CD24) | CSB-RP104644h | Cusabio

Alternative Name(s): Small cell lung carcinoma cluster 4 antigen; CD24

Gene Names: CD24

Research Areas: Immunology

Organism: Homo sapiens (Human)

AA Sequence: SETTTGTSSNSSQSTSNTGLAPNPTNATTKAAGGALQSTASLFVVSLSLLHLYS

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 27-80aa

Sequence Info: Full Length of Mature Protein

MW: 32.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Modulates B-cell activation responses. Signaling could be triggered by the binding of a lectin-like ligand to the CD24 carbohydrates, and transduced by the release of second messengers derived from the GPI-anchor. Promotes AG-dependent proliferation of B-cells, and prevents their terminal differentiation into antibody-forming cells.

Reference: CD24, a signal transducer modulating B cell activation responses, is a very short peptide with a glycosyl phosphatidylinositol membrane anchor.Kay R., Rosten P.M., Humphries R.K.J. Immunol. 147:1412-1416(1991)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May have a pivotal role in cell differentiation of different cell types. Signaling could be triggered by the binding of a lectin-like ligand to the CD24 carbohydrates, and transduced by the release of second messengers derived from the GPI-anchor. Modulates B-cell activation responses. Promotes AG-dependent proliferation of B-cells, and prevents their terminal differentiation into antibody-forming cells

Involvement in disease: Multiple sclerosis (MS)

Subcellular Location: Cell membrane, Lipid-anchor, GPI-anchor

Protein Families: CD24 family

Tissue Specificity: B-cells. Expressed in a number of B-cell lines including P32/ISH and Namalwa. Expressed in erythroleukemia cell and small cell lung carcinoma cell lines. Also expressed on the surface of T-cells.

Paythway: Hematopoieticcelllineage

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P25063

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose