Recombinant Human Sialic acid-binding Ig-like lectin 15 (SIGLEC15), partial | CSB-MP761623HU

(No reviews yet) Write a Review
SKU:
CSB-MP761623HU
Availability:
3 - 7 Working Days
  • Recombinant Human Sialic acid-binding Ig-like lectin 15 (SIGLEC15), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$463.20 - $3,002.40

Description

Recombinant Human Sialic acid-binding Ig-like lectin 15 (SIGLEC15), partial | CSB-MP761623HU | Cusabio

Alternative Name(s): CD33 antigen-like 3

Gene Names: SIGLEC15

Research Areas: Others

Organism: Homo sapiens (Human)

AA Sequence: FVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGAST

Source: Mammalian cell

Tag Info: N-terminal 6xHis-tagged

Expression Region: 20-263aa

Sequence Info: Partial

MW: 30.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Binds sialylated glycoproteins.

Reference: "Siglec-15: an immune system Siglec conserved throughout vertebrate evolution."Angata T., Tabuchi Y., Nakamura K., Nakamura M.Glycobiology 17:838-846(2007)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Binds sialylated glycoproteins.

Involvement in disease:

Subcellular Location: Membrane, Single-pass type I membrane protein

Protein Families: Immunoglobulin superfamily, SIGLEC (sialic acid binding Ig-like lectin) family

Tissue Specificity: Expressed in macrophage and/or dendritic cells of spleen and lymph nodes.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q6ZMC9

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose