Recombinant Human Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform (PPP2CB) | CSB-EP018560HU

Recombinant Human Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform (PPP2CB) | CSB-EP018560HU | Cusabio

Alternative Name(s): PP2A beta; PP2A-beta; PP2AB_HUMAN; PP2Abeta; PP2CB; Ppp2cb; Protein phosphatase 2 (formerly 2A); catalytic subunit; beta isoform; Protein phosphatase 2 catalytic subunit beta isozyme; Protein phosphatase 2; catalytic subunit; beta isoform; Protein phosphatase 2A catalytic subunit beta isoform; Protein phosphatase type 2A catalytic subunit; Serine/threonine protein phosphatase 2A catalytic subunit beta; Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform

Gene Names: PPP2CB

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: MDDKAFTKELDQWVEQLNECKQLNENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-309aa

Sequence Info: Full Length

MW: 62.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: PP2A can modulate the activity of phosphorylase B kinase casein kinase 2, mitogen-stimulated S6 kinase, and MAP-2 kinase.

Reference: The nucleotide sequence of the cDNA encoding the human lung protein phosphatase 2A beta catalytic subunit.Hemmings B.A., Wernet W., Mayer R., Maurer F., Hofsteenge J., Stone S.R.Nucleic Acids Res. 16:11366-11366(1988)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: PP2A can modulate the activity of phosphorylase B kinase casein kinase 2, mitogen-stimulated S6 kinase, and MAP-2 kinase.

Involvement in disease:

Subcellular Location: Cytoplasm, Nucleus, Chromosome, centromere, Cytoplasm, cytoskeleton, spindle pole

Protein Families: PPP phosphatase family, PP-1 subfamily

Tissue Specificity:

Paythway: Hipposignalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P62714

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM