Cusabio Human Recombinants
Recombinant Human Sentrin-specific protease 8 (SENP8) | CSB-EP822251HU
- SKU:
- CSB-EP822251HU
- Availability:
- 13 - 23 Working Days
Description
Recombinant Human Sentrin-specific protease 8 (SENP8) | CSB-EP822251HU | Cusabio
Alternative Name(s): Deneddylase-1NEDD8-specific protease 1;Protease, cysteine 2Sentrin/SUMO-specific protease SENP8
Gene Names: SENP8
Research Areas: Epigenetics and Nuclear Signaling
Organism: Homo sapiens (Human)
AA Sequence: MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVSFISPEVTQFIKCTSNPAEIAMFLEPLDLPNKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDSHSRSNSVHAKQVAEKLEAFLGRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFRQQTESLLQLLTPAYITKKRGEWKDLITTLAKK
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
Expression Region: 1-212aa
Sequence Info: Full Length
MW: 40.1 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Protease that catalyzes two essential functions in the NEDD8 pathway: processing of full-length NEDD8 to its mature form and deconjugation of NEDD8 from targeted proteins such as cullins or p53.
Reference: Structure of a complex between Nedd8 and the Ulp/Senp protease family member Den1.Reverter D., Wu K., Erdene T.G., Pan Z.-Q., Wilkinson K.D., Lima C.D.J. Mol. Biol. 345:141-151(2005)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Protease that catalyzes two essential functions in the NEDD8 pathway
Involvement in disease:
Subcellular Location:
Protein Families: Peptidase C48 family
Tissue Specificity: Broadly expressed, with highest levels in kidney and pancreas.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q96LD8
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM