Recombinant Human Selenoprotein P (SEPP1) (U59S, U300S, U318S, U330S, U345S, U352S, U367S, U369S, U376S, U378S) | CSB-YP021018HU

(No reviews yet) Write a Review
SKU:
CSB-YP021018HU
Availability:
25 - 35 Working Days
  • Recombinant Human Selenoprotein P (SEPP1) (U59S, U300S, U318S, U330S, U345S, U352S, U367S, U369S, U376S, U378S)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£209.60 - £1,124.80

Description

Recombinant Human Selenoprotein P (SEPP1) (U59S, U300S, U318S, U330S, U345S, U352S, U367S, U369S, U376S, U378S) | CSB-YP021018HU | Cusabio

Alternative Name(s): Selenoprotein P; Selenoprotein P plasma 1; Selp; SeP; Sepp1; SEPP1_HUMAN

Gene Names: SEPP1

Research Areas: Others

Organism: Homo sapiens (Human)

AA Sequence: ESQDQSSLCKQPPAWSIRDQDPMLNSNGSVTVVALLQASSYLCILQASKLEDLRVKLKKEGYSNISYIVVNHQGISSRLKYTHLKNKVSEHIPVYQQEENQTDVWTLLNGSKDDFLIYDRCGRLVYHLGLPFSFLTFPYVEEAIKIAYCEKKCGNCSLTTLKDEDFCKRVSLATVDKTVETPSPHYHHEHHHNHGHQHLGSSELSENQQPGAPNAPTHPAPPGLHHHHKHKGQHRQGHPENRDMPASEDLQDLQKKLCRKRCINQLLCKLPTDSELAPRSSCCHCRHLIFEKTGSAITSQCKENLPSLCSSQGLRAEENITESCQSRLPPAASQISQQLIPTEASASSRSKNQAKKSESPSN

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 20-381aa(U59S,U300S,U318S,U330S,U345S,U352S,U367S,U369S,U376S,U378S)

Sequence Info: Full Length of Mature Protein

MW: 42.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Might be responsible for some of the Extracellular domain antioxidant defense properties of selenium or might be involved in the transport of selenium. May supply selenium to tissues such as brain and testis.

Reference: Conserved nucleotide sequences in the open reading frame and 3' untranslated region of selenoprotein P mRNA.Hill K.E., Lloyd R.S., Burk R.F.Proc. Natl. Acad. Sci. U.S.A. 90:537-541(1993)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Might be responsible for some of the extracellular antioxidant defense properties of selenium or might be involved in the transport of selenium. May supply selenium to tissues such as brain and testis.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Selenoprotein P family

Tissue Specificity: Made in the liver and heart and secreted into the plasma. It is also found in the kidney.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P49908

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose