Cusabio Human Recombinants
Recombinant Human Secreted Ly-6/uPAR-related protein 1 (SLURP1) | CSB-YP021784HU
- SKU:
 - CSB-YP021784HU
 - Availability:
 - 25 - 35 Working Days
 
Description
Recombinant Human Secreted Ly-6/uPAR-related protein 1 (SLURP1) | CSB-YP021784HU | Cusabio
Alternative Name(s): ARS component B ARS(component B)-81/S Anti-neoplastic urinary protein Short name: ANUP
Gene Names: SLURP1
Research Areas: Cardiovascular
Organism: Homo sapiens (Human)
AA Sequence: LKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSEL
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
Expression Region: 23-103aa
Sequence Info: Full Length of Mature Protein
MW: 10.9 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Has an antitumor activity. Was found to be a marker of late differentiation of the skin. Implicated in maintaining the physiological and structural integrity of the keratinocyte layers of the skin.
Reference: "Partial N-terminal amino acid sequence of the anti-neoplastic urinary protein (ANUP) and the anti-tumour effect of the N-terminal nonapeptide of the unique cytokine present in human granulocytes."Ridge R.J., Sloane N.H.Cytokine 8:1-5(1996)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Has an antitumor activity
Involvement in disease: Mal de Meleda (MDM)
Subcellular Location: Secreted
Protein Families:
Tissue Specificity: Granulocytes. Expressed in skin. Predominantly expressed in the granular layer of skin, notably the acrosyringium. Identified in several biological fluids such as sweat, saliva, tears, plasma and urine.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P55000
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM