Cusabio Human Recombinants
Recombinant Human Scrapie-responsive protein 1 (SCRG1) | CSB-EP530448HUa0
- SKU:
- CSB-EP530448HUa0
- Availability:
- 3 - 7 Working Days
Description
Recombinant Human Scrapie-responsive protein 1 (SCRG1) | CSB-EP530448HUa0 | Cusabio
Alternative Name(s): Scrapie-responsive gene 1 protein ;ScRG-1
Gene Names: SCRG1
Research Areas: Neuroscience
Organism: Homo sapiens (Human)
AA Sequence: MPANRLSCYRKILKDHNCHNLPEGVADLTQIDVNVQDHFWDGKGCEMICYCNFSELLCCPKDVFFGPKISFVIPCNNQ
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
Expression Region: 21-98aa
Sequence Info: Full Length of Mature Protein
MW: 12.9 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Relevance:
Reference: Characterization of the human analogue of a scrapie-responsive gene.Dron M., Dandoy-Dron F., Guillo F., Benboudjema L., Hauw J.-J., Lebon P., Dormont D., Tovey M.G.J. Biol. Chem. 273:18015-18018(1998)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location: Secreted
Protein Families: SCRG1 family
Tissue Specificity: Expressed abundantly in the central nervous system of adult, but not at all in fetal brain. High levels of SCRG1 transcripts are also observed in testis and aorta.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: O75711
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM