Recombinant Human SARS coronavirus Spike glycoprotein (S) , partial | CSB-YP348663HQEa4

Recombinant Human SARS coronavirus Spike glycoprotein (S) , partial | CSB-YP348663HQEa4 | Cusabio

Target Name: S

Uniprot No: P59594

Species: Human SARS coronavirus (SARS-CoV) (Severe acute respiratory syndrome coronavirus)

Source: Yeast

Tag Info: N-terminal 6xHis-sumostar-tagged

Expression Region: 306-527aa

Sequence Description: Partial

Target Protein Sequence: RVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNF

Mol. Weight: 39 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test.

Biological Activity: N/A

Form: Lyophilized powder

Buffer: Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.