Recombinant Human Sal-like protein 2 (SALL2) | CSB-MP896719HU

Recombinant Human Sal-like protein 2 (SALL2) | CSB-MP896719HU | Cusabio

Alternative Name(s): Zinc finger protein 795 Zinc finger protein SALL2 Zinc finger protein Spalt-2 Short name: Sal-2 Short name: hSal2

Gene Names: SALL2

Research Areas: Epigenetics and Nuclear Signaling

Organism: Homo sapiens (Human)

AA Sequence: QTNTKATGKCNPNLHYWTAQEQHNAAGIAWIPYFGPGAEGIYTEGLMHNQNALVCGLRQLANETTQALQLFLRATTELRTYTILNRKAIDFLLRRWGGTCRILGPDCCIEPHDWTKNITDKINQIIHDFIDNPLPN

Source: Mammalian cell

Tag Info: N-terminal Flag-Myc-tagged

Expression Region: 1-198aa

Sequence Info: Partial

MW: 25.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Probable transcription factor that plays a role in eye development before, during, and after optic fissure closure.

Reference: "Mutation of SALL2 causes recessive ocular coloboma in humans and mice."Kelberman D., Islam L., Lakowski J., Bacchelli C., Chanudet E., Lescai F., Patel A., Stupka E., Buck A., Wolf S., Beales P.L., Jacques T.S., Bitner-Glindzicz M., Liasis A., Lehmann O.J., Kohlhase J., Nischal K.K., Sowden J.C.Hum. Mol. Genet. 23:2511-2526(2014)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Probable transcription factor that plays a role in eye development before, during, and after optic fissure closure.

Involvement in disease: Coloboma, ocular, autosomal recessive (COAR)

Subcellular Location: Nucleus

Protein Families: Sal C2H2-type zinc-finger protein family

Tissue Specificity: Highest levels in adult brain (in different areas). Lower levels in heart; very low levels in kidney and pancreas. Expressed throughout the retina and lens vesicle as well as the periocular mesenchyme.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9Y467

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM