Cusabio Human Recombinants
Recombinant Human Ropporin-1B (ROPN1B) | CSB-YP020065HU
- SKU:
- CSB-YP020065HU
- Availability:
- 25 - 35 Working Days
Description
Recombinant Human Ropporin-1B (ROPN1B) | CSB-YP020065HU | Cusabio
Alternative Name(s): Rhophilin-associated protein 1B
Gene Names: ROPN1B
Research Areas: Signal Transduction
Organism: Homo sapiens (Human)
AA Sequence: MWKVVNLPTDLFNSVMNVGRFTEEIEWLKFLALACSALGVTITKTLKIVCEVLSCDHNGGLPRIPFSTFQFLYTYIAEVDGEICASHVSRMLNYIEQEVIGPDGLITVNDFTQNPRVWLE
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
Expression Region: 1-120aa
Sequence Info: Full Length of isoform 2
MW: 15.6 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance:
Reference: "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."The MGC Project Team Genome Res. 14:2121-2127(2004)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Important for male fertility. With ROPN1L, involved in fibrous sheath integrity and sperm motility, plays a role in PKA-dependent signaling processes required for spermatozoa capacitation.
Involvement in disease:
Subcellular Location: Cell projection, cilium, flagellum
Protein Families: Ropporin family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q9BZX4
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM