Cusabio Human Recombinants
Recombinant Human Ribonucleoprotein PTB-binding 2 (RAVER2), partial | CSB-YP872547HU
- SKU:
- CSB-YP872547HU
- Availability:
- 25 - 35 Working Days
Description
Recombinant Human Ribonucleoprotein PTB-binding 2 (RAVER2), partial | CSB-YP872547HU | Cusabio
Alternative Name(s): Protein raver-2
Gene Names: RAVER2
Research Areas: Epigenetics and Nuclear Signaling
Organism: Homo sapiens (Human)
AA Sequence: MAAAAGDGGGEGGAGLGSAAGLGPGPGLRGQGPSAEAHEGAPDPMPAALHPEEVAARLQRMQRELSNRRKILVKNLPQDSNCQEVHDLLKDYDLKYCYVDRNKRTAFVTLLNGEQAQNAIQMFHQYSFRGKDLIVQLQPT
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
Expression Region: 1-140aa
Sequence Info: Partial
MW: 17 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: May bind single-stranded nucleic acids.Curated
Reference: Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.Nagase T., Kikuno R., Nakayama M., Hirosawa M., Ohara O.DNA Res. 7:273-281(2000)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: May bind single-stranded nucleic acids.
Involvement in disease:
Subcellular Location: Nucleus, Cytoplasm
Protein Families:
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q9HCJ3
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM