Recombinant Human Ribonuclease P protein subunit p20 (POP7) | CSB-EP018375HU

Recombinant Human Ribonuclease P protein subunit p20 (POP7) | CSB-EP018375HU | Cusabio

Alternative Name(s): Ribonucleases P/MRP protein subunit POP7 homolog

Gene Names: POP7

Research Areas: Epigenetics and Nuclear Signaling

Organism: Homo sapiens (Human)

AA Sequence: MAENREPRGAVEAELDPVEYTLRKRLPSRLPRRPNDIYVNMKTDFKAQLARCQKLLDGGARGQNACSEIYIHGLGLAINRAINIALQLQAGSFGSLQVAANTSTVELVDELEPETDTREPLTRIRNNSAIHIRVFRVTPK

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-140aa

Sequence Info: Full Length

MW: 42.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends. Also a component of RNase MRP complex, which cleaves pre-rRNA sequences.

Reference: "Autoantigenic properties of some protein subunits of catalytically active complexes of human ribonuclease P." Jarrous N., Eder P.S., Guerrier-Takada C., Hoog C., Altman S. RNA 4:407-417(1998)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends. Also a component of RNase MRP complex, which cleaves pre-rRNA sequences.

Involvement in disease:

Subcellular Location: Nucleus, nucleolus, Cytoplasm, Cytoplasmic granule

Protein Families: Histone-like Alba family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O75817

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM