Recombinant Human Ribonuclease kappa (RNASEK) | CSB-CF761293HU

(No reviews yet) Write a Review
SKU:
CSB-CF761293HU
Availability:
18 - 23 Working Days
$1,512.00 - $2,558.40

Description

Recombinant Human Ribonuclease kappa (RNASEK) | CSB-CF761293HU | Cusabio

Alternative Name(s): RNase K (RNase kappa)

Gene Names: RNASEK

Research Areas: Others

Organism: Homo sapiens (Human)

AA Sequence: MGWLRPGPRPLCPPARASWAFSHRFPSPLAPRRSPTPFFMASLLCCGPKLAACGIVLSAWGVIMLIMLGIFFNVHSAVLIEDVPFTEKDFENGPQNIYNLYEQVSYNCFIAAGLYLLLGGFSFCQVRLNKRKEYMVR

Source: in vitro E.coli expression system

Tag Info: N-terminal 10xHis-tagged

Expression Region: 1-137aa

Sequence Info: Full Length

MW: 21.5 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Endoribonuclease which preferentially cleaves ApU and ApG phosphodiester bonds. Hydrolyzes UpU bonds at a lower rate.

Reference: "Molecular cloning and characterization of the human RNase kappa, an ortholog of Cc RNase." Economopoulou M.-A., Fragoulis E.G., Sideris D.C. Nucleic Acids Res. 35:6389-6398(2007)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q6P5S7

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose