Recombinant Human Rhodopsin (RHO), partial | CSB-EP019681HU

(No reviews yet) Write a Review
SKU:
CSB-EP019681HU
Availability:
13 - 23 Working Days
  • Recombinant Human Rhodopsin (RHO), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£238.40 - £1,361.60

Description

Recombinant Human Rhodopsin (RHO), partial | CSB-EP019681HU | Cusabio

Alternative Name(s): Opsin-2

Gene Names: RHO

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: MNGTEGPNFYVPFSNATGVVRSPFEYPQYYLAEPWQ

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-36aa

Sequence Info: Partial

MW: 20.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Photoreceptor required for image-forming vision at low light intensity. Required for photoreceptor cell viability after birth. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change leading to G-protein activation and release of all-trans retinal.

Reference: "Isolation and nucleotide sequence of the gene encoding human rhodopsin."Nathans J., Hogness D.S.Proc. Natl. Acad. Sci. U.S.A. 81:4851-4855(1984)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Photoreceptor required for image-forming vision at low light intensity

Involvement in disease: Retinitis pigmentosa 4 (RP4); Night blindness, congenital stationary, autosomal dominant 1 (CSNBAD1)

Subcellular Location: Membrane, Multi-pass membrane protein, Cell projection, cilium, photoreceptor outer segment

Protein Families: G-protein coupled receptor 1 family, Opsin subfamily

Tissue Specificity: Rod shaped photoreceptor cells which mediate vision in dim light.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P08100

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose