Recombinant Human Resistin-like beta (RETNLB) | CSB-YP860653HU

Recombinant Human Resistin-like beta (RETNLB) | CSB-YP860653HU | Cusabio

Alternative Name(s): Colon and small intestine-specific cysteine-rich protein Colon carcinoma-related gene protein Cysteine-rich secreted protein A12-alpha-like 1 Cysteine-rich secreted protein FIZZ2 RELMbeta

Gene Names: RETNLB

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: QCSLDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAGMAVTGCACGYGCGSWDVQLETTCHCQCSVVDWTTARCCHLT

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 24-111aa

Sequence Info: Full Length of Mature Protein

MW: 11.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Probable hormone.

Reference: "A family of tissue-specific resistin-like molecules."Steppan C.M., Brown E.J., Wright C.M., Bhat S., Banerjee R.R., Dai C.Y., Enders G.H., Silberg D.G., Wen X., Wu G.D., Lazar M.A.Proc. Natl. Acad. Sci. U.S.A. 98:502-506(2001).

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Probable hormone.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Resistin/FIZZ family

Tissue Specificity: Expressed only in the gastrointestinal tract, particularly the colon.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9BQ08

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM