Recombinant Human Regulator of G-protein signaling 10 (RGS10) | CSB-EP019642HU

(No reviews yet) Write a Review
SKU:
CSB-EP019642HU
Availability:
13 - 23 Working Days
  • Recombinant Human Regulator of G-protein signaling 10 (RGS10)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€245.00 - €1,277.00

Description

Recombinant Human Regulator of G-protein signaling 10 (RGS10) | CSB-EP019642HU | Cusabio

Alternative Name(s): Regulator of G protein signaling 10; Regulator of G-protein signaling 10; RGS10; RGS10_HUMAN

Gene Names: RGS10

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: MFNRAVSRLSRKRPPSDIHDSDGSSSSSHQSLKSTAKWAASLENLLEDPEGVKRFREFLKKEFSEENVLFWLACEDFKKMQDKTQMQEKAKEIYMTFLSSKASSQVNVEGQSRLNEKILEEPHPLMFQKLQDQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEDLPDAQTAAKRASRIYNT

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-181aa

Sequence Info: Full Length of Isoform 3

MW: 48.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Regulates G protein-coupled receptor signaling cascades, including signaling downstream of the muscarinic acetylcholine receptor CHRM2. Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form. Modulates the activity of potassium channels that are activated in response to CHRM2 signaling. Activity on GNAZ is inhibited by palmitoylation of the G-protein

Reference: "RGS10 is a selective activator of G alpha i GTPase activity." Hunt T.W., Fields T.A., Casey P.J., Peralta E.G. Nature 383:175-177(1996)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Regulates G protein-coupled receptor signaling cascades, including signaling downstream of the muscarinic acetylcholine receptor CHRM2. Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form

Involvement in disease:

Subcellular Location: Cytoplasm, cytosol, Nucleus

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O43665

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose