Cusabio Human Recombinants
Recombinant Human Recoverin (RCVRN) | CSB-MP019519HU
- SKU:
- CSB-MP019519HU
- Availability:
- 3 - 7 Working Days
Description
Recombinant Human Recoverin (RCVRN) | CSB-MP019519HU | Cusabio
Alternative Name(s): Cancer-associated retinopathy protein (Protein CAR) (RCV1)
Gene Names: RCVRN
Research Areas: Neuroscience
Organism: Homo sapiens (Human)
AA Sequence: GNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKNA
Source: Mammalian cell
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region: 2-200aa
Sequence Info: Full Length of Mature Protein
MW: 27.0 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Seems to be implicated in the pathway from retinal rod guanylate cyclase to rhodopsin. May be involved in the inhibition of the phosphorylation of rhodopsin in a calcium-dependent manner. The calcium-bound recoverin prolongs the photoresponse.
Reference: "Isolation of human retinal genes: recoverin cDNA and gene."Murakami A., Yajima T., Inana G.Biochem. Biophys. Res. Commun.187:234-244(1992)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Seems to be implicated in the pathway from retinal rod guanylate cyclase to rhodopsin. May be involved in the inhibition of the phosphorylation of rhodopsin in a calcium-dependent manner. The calcium-bound recoverin prolongs the photoresponse.
Involvement in disease:
Subcellular Location:
Protein Families: Recoverin family
Tissue Specificity: Retina and pineal gland.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P35243
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM