Recombinant Human Ras-related protein Rap-2b (RAP2B) | CSB-EP019327HU

(No reviews yet) Write a Review
SKU:
CSB-EP019327HU
Availability:
13 - 23 Working Days
  • Recombinant Human Ras-related protein Rap-2b (RAP2B)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€245.00 - €1,277.00

Description

Recombinant Human Ras-related protein Rap-2b (RAP2B) | CSB-EP019327HU | Cusabio

Alternative Name(s): MGC20484; RAP 2B; RAP2A; Rap2b; RAP2B member of RAS oncogene family; RAP2B_HUMAN; Ras family small GTP binding protein RAP2B; Ras related protein RAP 2B; Ras related protein RAP2B; Ras-related protein Rap-2b; Small GTP binding protein

Gene Names: RAP2B

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: MREYKVVVLGSGGVGKSALTVQFVTGSFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYERVPMILVGNKVDLEGEREVSYGEGKALAEEWSCPFMETSAKNKASVDELFAEIVRQMNYAAQPNGDEGCCSAC

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-183aa

Sequence Info: Full Length

MW: 47.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Small GTP-binding protein which cycles between a GDP-bound inactive and a GTP-bound active form. Involved in EGFR and CHRM3 signaling pathways through stimulation of PLCE1. May play a role in cytoskeletal rearrangements and regulate cell spreading through activation of the effector TNIK. May regulate membrane vesiculation in red blood cells.

Reference: "RAP2B: a RAS-related GTP-binding protein from platelets." Ohmstede C.A., Farrell F.X., Reep B.R., Clemetson K.J., Lapetina E.G. Proc. Natl. Acad. Sci. U.S.A. 87:6527-6531(1990)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Small GTP-binding protein which cycles between a GDP-bound inactive and a GTP-bound active form. Involved in EGFR and CHRM3 signaling pathways through stimulation of PLCE1. May play a role in cytoskeletal rearrangements and regulate cell spreading through activation of the effector TNIK. May regulate membrane vesiculation in red blood cells.

Involvement in disease:

Subcellular Location: Recycling endosome membrane, Lipid-anchor, Cytoplasmic side

Protein Families: Small GTPase superfamily, Ras family

Tissue Specificity: Expressed in red blood cells (at protein level).

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P61225

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose