Recombinant Human Ras-related protein Rab-5B (RAB5B) | CSB-EP019214HU

Recombinant Human Ras-related protein Rab-5B (RAB5B) | CSB-EP019214HU | Cusabio

Alternative Name(s): RAB5B; Ras-related protein Rab-5B

Gene Names: RAB5B

Research Areas: Neuroscience

Organism: Homo sapiens (Human)

AA Sequence: TSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQSVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQRQASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKKLPKSEPQNLGGAAGRSRGVDLHEQSQQNKSQCCSN

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-215aa

Sequence Info: Full Length

MW: 50.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Protein transport. Probably involved in vesicular traffic .

Reference: "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach." Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S. Anal. Chem. 81:4493-4501(2009)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Protein transport. Probably involved in vesicular traffic (By similarity).

Involvement in disease:

Subcellular Location: Cell membrane, Lipid-anchor, Cytoplasmic side, Early endosome membrane, Lipid-anchor, Melanosome

Protein Families: Small GTPase superfamily, Rab family

Tissue Specificity:

Paythway: Rassignalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P61020

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM