null

Recombinant Human Ras-related protein Rab-4A (RAB4A) | CSB-EP019211HU

(No reviews yet) Write a Review
SKU:
CSB-EP019211HU
Availability:
13 - 23 Working Days
  • Recombinant Human Ras-related protein Rab-4A (RAB4A)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£196.00 - £1,021.60
Frequently bought together:

Description

Recombinant Human Ras-related protein Rab-4A (RAB4A) | CSB-EP019211HU | Cusabio

Alternative Name(s): HRES 1 / RAB4; Oncogene RAB4; Rab 4; RAB 4A; RAB4 member RAS oncogene family; Rab4a; RAB4A member RAS oncogene family; RAB4A_HUMAN; Ras related protein Rab 4A; Ras related protein Rab4A; Ras-related protein Rab-4A

Gene Names: RAB4A

Research Areas: Tags & Cell Markers

Organism: Homo sapiens (Human)

AA Sequence: MSQTAMSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESGELDPERMGSGIQYGDAALRQLRSPRRAQAPNAQECGC

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-218aa

Sequence Info: Full Length

MW: 51.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Protein transport. Probably involved in vesicular traffic .

Reference: "The human Rab genes encode a family of GTP-binding proteins related to yeast YPT1 and SEC4 products involved in secretion." Zahraoui A., Touchot N., Chardin P., Tavitian A. J. Biol. Chem. 264:12394-12401(1989)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Protein transport. Probably involved in vesicular traffic (By similarity).

Involvement in disease:

Subcellular Location: Membrane, Peripheral membrane protein, Cytoplasm, Early endosome membrane, Peripheral membrane protein, Recycling endosome membrane, Peripheral membrane protein

Protein Families: Small GTPase superfamily, Rab family

Tissue Specificity:

Paythway: Endocytosis

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P20338

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose