Recombinant Human Ras-related protein Rab-27B (RAB27B) | CSB-EP019178HU

Recombinant Human Ras-related protein Rab-27B (RAB27B) | CSB-EP019178HU | Cusabio

Alternative Name(s): C25KG

Gene Names: RAB27B

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: TDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAQGPNGSSGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDLIMKRMEQCVEKTQIPDTVNGGNSGNLDGEKPPEKKCIC

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 2-218aa

Sequence Info: Full Length of Mature Protein

MW: 40.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: May be involved in targeting uroplakins to urothelial apical mbranes.

Reference: Molecular cloning and characterization of rab27a and rab27b, novel human rab proteins shared by melanocytes and platelets.Chen D., Guo J., Miki T., Tachibana M., Gahl W.A.Biochem. Mol. Med. 60:27-37(1997)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May be involved in targeting uroplakins to urothelial apical membranes.

Involvement in disease:

Subcellular Location: Membrane, Lipid-anchor

Protein Families: Small GTPase superfamily, Rab family

Tissue Specificity: Expressed primarily in testis.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O00194

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM