Recombinant Human Ras-related protein Rab-18 (RAB18) | CSB-EP878835HU

Recombinant Human Ras-related protein Rab-18 (RAB18) | CSB-EP878835HU | Cusabio

Alternative Name(s): AA959686; RAB18; RAB18 small GTPase; RAB18; member RAS oncogene family; RAB18_HUMAN; RAB18LI1; Ras related protein Rab 18; Ras-asssociated protein RAB18; Ras-related protein Rab-18; RP11-148B2.1; WARBM3

Gene Names: RAB18

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: MDEDVLTTLKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKENREVDRNEGLKFARKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREEGQGGGACGGYC

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-206aa

Sequence Info: Full Length

MW: 49.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Plays a role in apical endocytosis/recycling. May be implicated in transport between the plasma membrane and early endosomes. Plays a key role in eye and brain development and neurodegeneration.

Reference: "In silico cloning of the human Rab18 gene." Chikri M.M., Boutin M.P., Vaxillaire M.M., Froguel M.P. Submitted (APR-2000)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Plays a role in apical endocytosis/recycling. May be implicated in transport between the plasma membrane and early endosomes. Plays a key role in eye and brain development and neurodegeneration.

Involvement in disease: Warburg micro syndrome 3 (WARBM3)

Subcellular Location: Cell membrane, Lipid-anchor, Cytoplasmic side

Protein Families: Small GTPase superfamily, Rab family

Tissue Specificity: Ubiquitous.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9NP72

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM