Recombinant Human Ragulator complex protein LAMTOR3 (LAMTOR3) | CSB-EP013477HU

(No reviews yet) Write a Review
SKU:
CSB-EP013477HU
Availability:
13 - 23 Working Days
  • Recombinant Human Ragulator complex protein LAMTOR3 (LAMTOR3)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£196.00 - £1,021.60

Description

Recombinant Human Ragulator complex protein LAMTOR3 (LAMTOR3) | CSB-EP013477HU | Cusabio

Alternative Name(s): Late endosomal/lysosomal adaptor and MAPK and MTOR activator 3

Gene Names: LAMTOR3

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELRQVVEVS

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-124aa

Sequence Info: Full Length

MW: 40.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: As part of the Ragulator complex it is involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids. Activated by amino acids through a mechanism involving the lysosomal V-ATPase, the Ragulator functions as a guanine nucleotide exchange factor activating the small GTPases Rag. Activated Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated. Adapter protein that enhances the efficiency of the MAP kinase cascade facilitating the activation of MAPK2.

Reference: "Novel genes expressed in human dendritic cells." Li Y., Huang C., Ren S., Tu Y., Gu W., Wang Y., Han Z., Chen Z. Submitted (NOV-1999)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: As part of the Ragulator complex it is involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids. Activated by amino acids through a mechanism involving the lysosomal V-ATPase, the Ragulator functions as a guanine nucleotide exchange factor activating the small GTPases Rag. Activated Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated. Adapter protein that enhances the efficiency of the MAP kinase cascade facilitating the activation of MAPK2.

Involvement in disease:

Subcellular Location: Late endosome membrane, Peripheral membrane protein, Cytoplasmic side

Protein Families: LAMTOR3 family

Tissue Specificity:

Paythway: MAPKsignalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9UHA4

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose