Recombinant Human Pyridoxal kinase (PDXK) | CSB-EP017748HU

(No reviews yet) Write a Review
SKU:
CSB-EP017748HU
Availability:
13 - 23 Working Days
  • Recombinant Human Pyridoxal kinase (PDXK)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$294.00 - $1,532.40

Description

Recombinant Human Pyridoxal kinase (PDXK) | CSB-EP017748HU | Cusabio

Alternative Name(s): Pyridoxine kinase

Gene Names: PDXK

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: MEEECRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRNPAGSVVMERIRMDIRKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKAQAGEGVRPSPMQLELRMVQSKRDIEDPEIVVQATVL

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-312aa

Sequence Info: Full Length

MW: 62.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Required for synthesis of pyridoxal-5-phosphate from vitamin B6.

Reference: "Human pyridoxal kinase. cDNA cloning, expression, and modulation by ligands of the benzodiazepine receptor." Hanna M.C., Turner A.J., Kirkness E.F. J. Biol. Chem. 272:10756-10760(1997)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Required for synthesis of pyridoxal-5-phosphate from vitamin B6.

Involvement in disease:

Subcellular Location: Cytoplasm

Protein Families: Pyridoxine kinase family

Tissue Specificity: Ubiquitous. Isoform 3 is detected in adult testis and spermatozoa.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O00764

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose