Recombinant Human Pulmonary surfactant-associated protein C (SFTPC) | CSB-EP021174HU

(No reviews yet) Write a Review
SKU:
CSB-EP021174HU
Availability:
3 - 7 Working Days
  • Recombinant Human Pulmonary surfactant-associated protein C (SFTPC)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$294.00 - $1,532.40

Description

Recombinant Human Pulmonary surfactant-associated protein C (SFTPC) | CSB-EP021174HU | Cusabio

Alternative Name(s): Pulmonary surfactant-associated proteolipid SPL(Val) SP5

Gene Names: SFTPC

Research Areas: Cancer

Organism: Homo sapiens (Human)

AA Sequence: FGIPCCPVHLKRLLIVVVVVVLIVVVIVGALLMGL

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 24-58aa

Sequence Info: Full Length of Mature Protein

MW: 30.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Pulmonary surfactant associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces.

Reference: "Low molecular weight human pulmonary surfactant protein (SP5): isolation, characterization, and cDNA and amino acid sequences."Warr R.G., Hawgood S., Buckley D.I., Crisp T.M., Schilling J., Benson B.J., Ballard P.L., Clements J.A., White R.T.Proc. Natl. Acad. Sci. U.S.A. 84:7915-7919(1987)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Pulmonary surfactant associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces.

Involvement in disease: Pulmonary surfactant metabolism dysfunction 2 (SMDP2); Respiratory distress syndrome in premature infants (RDS)

Subcellular Location: Secreted, extracellular space, surface film

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P11686

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose