Cusabio Human Recombinants
Recombinant Human Prothymosin alpha (PTMA) | CSB-YP019000HUb0
- SKU:
- CSB-YP019000HUb0
- Availability:
- 3 - 7 Working Days
Description
Recombinant Human Prothymosin alpha (PTMA) | CSB-YP019000HUb0 | Cusabio
Alternative Name(s): TMSA
Gene Names: PTMA
Research Areas: Cell Biology
Organism: Homo sapiens (Human)
AA Sequence: MSDAAVDTSSEITTKDLKEKKEVVEEAENGRDAPANGNAENEENGEQEADNEVDEEEEEGGEEEEEEEEGDGEEEDGDEDEEAESATGKRAAEDDEDDDVDTKKQKTDEDD
Source: Yeast
Tag Info: N-terminal 10xHis-tagged
Expression Region: 1-111aa
Sequence Info: Full Length
MW: 14.7 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Relevance: Prothymosin alpha may mediate immune function by conferring resistance to certain opportunistic infections.
Reference: "The human prothymosin alpha gene is polymorphic and induced upon growth stimulation: evidence using a cloned cDNA." Eschenfeldt W.H., Berger S.L. Proc. Natl. Acad. Sci. U.S.A. 83:9403-9407(1986)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Prothymosin alpha may mediate immune function by conferring resistance to certain opportunistic infections.
Involvement in disease:
Subcellular Location: Nucleus
Protein Families: Pro/parathymosin family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P06454
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM