Recombinant Human Proteoglycan 4 (PRG4), partial | CSB-YP018672HU

Recombinant Human Proteoglycan 4 (PRG4), partial | CSB-YP018672HU | Cusabio

Alternative Name(s): Lubricin (Megakaryocyte-stimulating factor) (Superficial zone proteoglycan) (MSF) (SZP)

Gene Names: Prg4

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: QDLSSCAGRCGEGYSRDATCNCDYNCQHYMECCPDFKRVCTAELSCKGRCFESFERGRECDCDAQCKKYDKCCPDYESFCAEVHNPTSPPSSKKAPPPSGASQTIKSTTKRSPKPPNKKKTKKVIESEEITE

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 25-156aa

Sequence Info: Partial

MW: 16.8

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Plays a role in boundary lubrication within articulating joints. Prevents protein deposition onto cartilage from synovial fluid by controlling adhesion-dependent synovial growth and inhibiting the adhesion of synovial cells to the cartilage surface. Isoform F plays a role as a growth factor acting on the primitive cells of both hematopoietic and endothelial cell lineages.

Reference: "Purification, biochemical characterization, and cloning of a novel megakaryocyte stimulating factor that has megakaryocyte colony stimulating activity." Turner K.J., Fitz L.J., Temple P., Jacobs K., Larson D., Leary A.C., Kelleher K., Giannotti J., Calvetti J., Fitzgerald M., Kriz M.-J., Ferenz C., Grobholz J., Fraser H., Bean K., Norton C.R., Gesner T., Bhatia S. Clark S.C. Blood 78:279A-279A(1991)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q92954

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A