Recombinant Human Protein yippee-like 1 (YPEL1) | CSB-EP026270HU

(No reviews yet) Write a Review
SKU:
CSB-EP026270HU
Availability:
13 - 23 Working Days
  • Recombinant Human Protein yippee-like 1 (YPEL1)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$294.00 - $1,532.40

Description

Recombinant Human Protein yippee-like 1 (YPEL1) | CSB-EP026270HU | Cusabio

Alternative Name(s): DiGeorge Syndrome-Related Protein; Protein yippee-like 1; Yippee (Drosophila) Homolog-Like 1; Yippee-Like 1 (Drosophila); YPEL1; YPEL1_HUMAN

Gene Names: YPEL1

Research Areas: Epigenetics and Nuclear Signaling

Organism: Homo sapiens (Human)

AA Sequence: MVKMTKSKTFQAYLPNCHRTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIYCENCKTTLGWKYEHAFESSQKYKEGKFIIELAHMIKDNGWE

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-119aa

Sequence Info: Full Length

MW: 29.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: Identification and characterization of a novel gene family YPEL in a wide spectrum of eukaryotic species.Hosono K., Sasaki T., Minoshima S., Shimizu N.Gene 340:31-43(2004)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May play a role in epithelioid conversion of fibroblasts.

Involvement in disease:

Subcellular Location: Nucleus

Protein Families: Yippee family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O60688

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose