Recombinant Human Protein-tyrosine sulfotransferase 2 (TPST2) | CSB-EP024133HU

(No reviews yet) Write a Review
SKU:
CSB-EP024133HU
Availability:
13 - 23 Working Days
  • Recombinant Human Protein-tyrosine sulfotransferase 2 (TPST2)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£196.00 - £1,021.60

Description

Recombinant Human Protein-tyrosine sulfotransferase 2 (TPST2) | CSB-EP024133HU | Cusabio

Alternative Name(s): Tyrosylprotein sulfotransferase 2 ;TPST-2

Gene Names: TPST2

Research Areas: Cardiovascular

Organism: Homo sapiens (Human)

AA Sequence: QQVLECRAVLAGLRSPRGAMRPEQEELVMVGTNHVEYRYGKAMPLIFVGGVPRSGTTLMRAMLDAHPEVRCGEETRIIPRVLAMRQAWSKSGREKLRLDEAGVTDEVLDAAMQAFILEVIAKHGEPARVLCNKDPFTLKSSVYLSRLFPNSKFLLMVRDGRASVHSMITRKVTIAGFDLSSYRDCLTKWNKAIEVMYAQCMEVGKEKCLPVYYEQLVLHPRRSLKLILDFLGIAWSDAVLHHEDLIGKPGGVSLSKIERSTDQVIKPVNLEALSKWTGHIPGDVVRDMAQIAPMLAQLGYDPYANPPNYGNPDPFVINNTQRVLKGDYKTPANLKGYFQVNQNSTSSHLGSS

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 26-377aa

Sequence Info: Full Length of Mature Protein

MW: 55.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Catalyzes the O-sulfation of tyrosine residues within acidic motifs of polypeptides.

Reference: Existence of distinct tyrosylprotein sulfotransferase genes molecular characterization of tyrosylprotein sulfotransferase-2.Beisswanger R., Corbeil D., Vannier C., Thiele C., Dohrmann U., Kellner R., Ashman K., Niehrs C., Huttner W.B.Proc. Natl. Acad. Sci. U.S.A. 95:11134-11139(1998)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Catalyzes the O-sulfation of tyrosine residues within acidic motifs of polypeptides, using 3'-phosphoadenylyl sulfate (PAPS) as cosubstrate.

Involvement in disease:

Subcellular Location: Golgi apparatus membrane, Single-pass type II membrane protein

Protein Families: Protein sulfotransferase family

Tissue Specificity: Widely expressed.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O60704

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose