Recombinant Human Protein SSX4 (SSX4) | CSB-EP022736HU

Recombinant Human Protein SSX4 (SSX4) | CSB-EP022736HU | Cusabio

Alternative Name(s): Cancer/testis antigen 5.4

Gene Names: SSX4

Research Areas: Others

Organism: Homo sapiens (Human)

AA Sequence: MNGDDAFARRPRDDAQISEKLRKAFDDIAKYFSKKEWEKMKSSEKIVYVYMKLNYEVMTKLGFKVTLPPFMRSKRAADFHGNDFGNDRNHRNQVERPQMTFGSLQRIFPKIMPKKPAEEENGLKEVPEASGPQNDGKQLCPPGNPSTLEKINKTSGPKRGKHAWTHRLRERKQLVVYEEISDPEEDDE

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-188aa

Sequence Info: Full Length

MW: 48.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Could act as a modulator of transcription.

Reference: "CD4+ T cell responses to SSX-4 in melanoma patients." Ayyoub M., Merlo A., Hesdorffer C.S., Rimoldi D., Speiser D., Cerottini J.C., Chen Y.T., Old L.J., Stevanovic S., Valmori D. J. Immunol. 174:5092-5099(2005)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Could act as a modulator of transcription.

Involvement in disease:

Subcellular Location:

Protein Families: SSX family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O60224

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM