Recombinant Human Protein S100-A7A (S100A7A), partial | CSB-EP771423HU

(No reviews yet) Write a Review
SKU:
CSB-EP771423HU
Availability:
13 - 23 Working Days
  • Recombinant Human Protein S100-A7A (S100A7A), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£196.00 - £1,021.60

Description

Recombinant Human Protein S100-A7A (S100A7A), partial | CSB-EP771423HU | Cusabio

Alternative Name(s): S100A7A; S100A15; S100A7L1; Protein S100-A7A; S100 calcium-binding protein A15; S100 calcium-binding protein A7-like 1; S100 calcium-binding protein A7A

Gene Names: S100A7A

Research Areas: Cell Biology

Organism: Homo sapiens (Human)

AA Sequence: SNTQAERSIIGMIDMFHKYTGRDGKIEKPSLLTMMKENFPNFLSACDKKGIHYLATVFEKKDKNEDKKIDFSEFLSLLGDIAADYHKQSHGAAPCSGGSQ

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 2-101aa

Sequence Info: Partial

MW: 27.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: "The DNA sequence and biological annotation of human chromosome 1."Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May be involved in epidermal differentiation and inflammation and might therefore be important for the pathogenesis of psoriasis and other diseases.

Involvement in disease:

Subcellular Location: Cytoplasm

Protein Families: S-100 family

Tissue Specificity: Overexpressed in psoriasis.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q86SG5

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose