Recombinant Human Protein S100-A4 (S100A4) | CSB-EP020632HU

Recombinant Human Protein S100-A4 (S100A4) | CSB-EP020632HU | Cusabio

Alternative Name(s): Calvasculin;Metastasin;Placental calcium-binding protein;Protein Mts1S100 calcium-binding protein A4

Gene Names: S100A4

Research Areas: Cardiovascular

Organism: Homo sapiens (Human)

AA Sequence: ACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 2-101aa

Sequence Info: Full Length of Mature Protein

MW: 27.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: Transcriptional analysis of the mts1 gene with specific reference to 5' flanking sequences.Tulchinsky E.M., Ford H.L., Kramerov D., Reshetnyak E., Grigorian M., Zain S., Lukanidin E.Proc. Natl. Acad. Sci. U.S.A. 89:9146-9150(1992)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families: S-100 family

Tissue Specificity: Ubiquitously expressed.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P26447

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM