Recombinant Human Protein S100-A11 (S100A11) | CSB-EP020624HU

Recombinant Human Protein S100-A11 (S100A11) | CSB-EP020624HU | Cusabio

Alternative Name(s): Calgizzarin;Metastatic lymph node gene 70 protein ;MLN 70Protein S100-CS100 calcium-binding protein A11

Gene Names: S100A11

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: AKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 2-105aa

Sequence Info: Full Length of Mature Protein

MW: 27.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Facilitates the differentiation and the cornification of keratinocytes.

Reference: Human calgizzarin; one colorectal cancer-related gene selected by a large scale random cDNA sequencing and northern blot analysis.Tanaka M., Adzuma K., Iwami M., Yoshimoto K., Monden Y., Itakura M.Cancer Lett. 89:195-200(1995)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Facilitates the differentiation and the cornification of keratinocytes.

Involvement in disease:

Subcellular Location: Cytoplasm, Nucleus

Protein Families: S-100 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P31949

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM