Recombinant Human Protein phosphatase 1 regulatory subunit 1B (PPP1R1B) | CSB-EP880070HU

Recombinant Human Protein phosphatase 1 regulatory subunit 1B (PPP1R1B) | CSB-EP880070HU | Cusabio

Alternative Name(s): DARPP-32 Dopamine- and cAMP-regulated neuronal phosphoprotein

Gene Names: PPP1R1B

Research Areas: Neuroscience

Organism: Homo sapiens (Human)

AA Sequence: MLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGYPREEDEEEEEDDEEEEEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQVEDPALSEPGEEPQRPSPSEPGT

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-168aa

Sequence Info: Full Length of Isoform 2

MW: 45.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Inhibitor of protein-phosphatase 1.

Reference: "Expression of mRNAs encoding ARPP-16/19, ARPP-21, and DARPP-32 in human brain tissue." Brene S., Lindefors N., Ehrlich M., Taubes T., Horiuchi A., Kopp J., Hall H., Sedvall G., Greengard P., Persson H. J. Neurosci. 14:985-998(1994)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Inhibitor of protein-phosphatase 1.

Involvement in disease:

Subcellular Location: Cytoplasm

Protein Families: Protein phosphatase inhibitor 1 family

Tissue Specificity:

Paythway: cAMPsignalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9UD71

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM