Recombinant Human Protein disulfide-isomerase TMX3 (TMX3) | CSB-EP846645HU

Recombinant Human Protein disulfide-isomerase TMX3 (TMX3) | CSB-EP846645HU | Cusabio

Alternative Name(s): Thioredoxin domain-containing protein 10Thioredoxin-related transmembrane protein 3

Gene Names: TMX3

Research Areas: Metabolism

Organism: Homo sapiens (Human)

AA Sequence: KGFVEDLDESFKENRNDDIWLVDFYAPWCGHCKKLEPIWNEVGLEMKSIGSPVKVGKMDATSYSSIASEFGVRGYPTIKLLKGDLAYNYRGPRTKDDIIEFAHRVSGALIRPLPSQQMFEHMQKRHRVFFVYVGGESPLKEKYIDAASELIVYTYFFSASEEVVPEVIFKI

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 25-195aa

Sequence Info: Full Length of Isoform 2

MW: 35.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Probable disulfide isomerase, which participates in the folding of proteins containing disulfide bonds. May act as a dithiol oxidase.

Reference: Prediction of the coding sequences of unidentified human genes. XX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.Nagase T., Nakayama M., Nakajima D., Kikuno R., Ohara O.DNA Res. 8:85-95(2001)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Probable disulfide isomerase, which participates in the folding of proteins containing disulfide bonds. May act as a dithiol oxidase.

Involvement in disease:

Subcellular Location: Endoplasmic reticulum membrane, Single-pass membrane protein

Protein Families: Protein disulfide isomerase family

Tissue Specificity: Widely expressed. Expressed in brain, testis, lung, skin, kidney, uterus, bone, stomach, liver, prostate, placenta, eye and muscle.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q96JJ7

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM