Recombinant Human Protein BEX3 (NGFRAP1) | CSB-EP015781HU

Recombinant Human Protein BEX3 (NGFRAP1) | CSB-EP015781HU | Cusabio

Alternative Name(s): Brain-expressed X-linked protein 3Nerve growth factor receptor-associated protein 1Ovarian granulosa cell 13.0KDA protein HGR74p75NTR-associated cell death executor

Gene Names: NGFRAP1

Research Areas: Apoptosis

Organism: Homo sapiens (Human)

AA Sequence: MANIHQENEEMEQPMQNGEEDRPLGGGEGHQPAGNRRGQARRLAPNFRWAIPNRQINDGMGGDGDDMEIFMEEMREIRRKLRELQLRNCLRILMGELSNHHDHHDEFCLMP

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-111aa

Sequence Info: Full Length

MW: 40 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: May be a signaling adapter molecule involved in p75NTR-mediated apoptosis induced by NGF. Plays a role in zinc-triggered neuronal death . May play an important role in the pathogenesis of neurogenetic diseases.

Reference: A comparative gene expression profile of the whole eye from human, mouse, and guinea pig.Zhou X., Wang W., Lu F., Hu S., Jiang L., Yan D., Zhang X., Yu X., Yu J., Qu J.Mol. Vis. 13:2214-2221(2007)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May be a signaling adapter molecule involved in p75NTR-mediated apoptosis induced by NGF. Plays a role in zinc-triggered neuronal death (By similarity). May play an important role in the pathogenesis of neurogenetic diseases.

Involvement in disease:

Subcellular Location: Nucleus, Cytoplasm

Protein Families: BEX family

Tissue Specificity: Found in ovarian granulosa cells, testis, prostate and seminal vesicle tissue. High levels also detected in liver.

Paythway: Neurotrophinsignalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q00994

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM