Recombinant Human Programmed cell death protein 5 (PDCD5) | CSB-EP017671HU

Recombinant Human Programmed cell death protein 5 (PDCD5) | CSB-EP017671HU | Cusabio

Alternative Name(s): TF-1 cell apoptosis-related protein 19

Gene Names: PDCD5

Research Areas: Cell Biology

Organism: Homo sapiens (Human)

AA Sequence: MADEELEALRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAVENYLIQMARYGQLSEKVSEQGLIEILKKVSQQTEKTTTVKFNRRKVMDSDEDDDY

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-125aa

Sequence Info: Full Length

MW: 41.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: May function in the process of apoptosis.

Reference: "TFAR19, a novel apoptosis-related gene cloned from human leukemia cell line TF-1, could enhance apoptosis of some tumor cells induced by growth factor withdrawal." Liu H.T., Wang Y.G., Zhang Y.M., Song Q.S., Di C.H., Chen G., Tang J., Ma D.L. Biochem. Biophys. Res. Commun. 254:203-210(1999)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May function in the process of apoptosis.

Involvement in disease:

Subcellular Location:

Protein Families: PDCD5 family

Tissue Specificity: Widely expressed. Highest levels in heart, testis, kidney, pituitary gland, adrenal gland and placenta.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O14737

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM