Recombinant Human Programmed cell death protein 2-like (PDCD2L) | CSB-EP871560HU

(No reviews yet) Write a Review
SKU:
CSB-EP871560HU
Availability:
13 - 23 Working Days
  • Recombinant Human Programmed cell death protein 2-like (PDCD2L)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$357.60 - $2,042.40

Description

Recombinant Human Programmed cell death protein 2-like (PDCD2L) | CSB-EP871560HU | Cusabio

Alternative Name(s): PDCD2L; Programmed cell death protein 2-like

Gene Names: PDCD2L

Research Areas: Cell Biology

Organism: Homo sapiens (Human)

AA Sequence: AAVLKPVLLGLRDAPVHGSPTGPGAWTASKLGGIPDALPTVAAPRPVCQRCGQPLALVVQVYCPLEGSPFHRLLHVFACACPGCSTGGARSWKVFRSQCLQVPEREAQDAQKQGNSLAAEDWCEGADDWGSDTEEGPSPQFTLDFGNDASSAKDVDWTARLQDLRLQDAVLGAAHPVPPGLPLFLPYYICVADEDDYRDFVNLDHAHSLLRDYQQREGIAMDQLLSQSLPNDGDEKYEKTIIKSGDQTFYKFMKRIAACQEQILRYSWSGEPLFLTCPTSEVTELPACSQCGGQRIFEFQLMPALVSMLKSANLGLSVEFGTILVYTCEKSCWPPNHQTPMEEFCIIQEDPDELLFK

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-358aa

Sequence Info: Full Length

MW: 66.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Over-expression suppresses AP1, CREB, NFAT, and NF-kB transcriptional activation, and delays cell cycle progression at S phase.

Reference: "The novel MGC13096 protein is correlated with proliferation." Chen Q., Yan C., Yan Q., Feng L., Chen J., Qian K. Cell Biochem. Funct. 26:141-145(2008)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Over-expression suppresses AP1, CREB, NFAT, and NF-kB transcriptional activation, and delays cell cycle progression at S phase.

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity: Higher expression in lung, colon, mammary gland, cervix, stomach and small intestine.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9BRP1

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose