Recombinant Human Proepiregulin (EREG), partial | CSB-EP007779HU

(No reviews yet) Write a Review
SKU:
CSB-EP007779HU
Availability:
13 - 23 Working Days
  • Recombinant Human Proepiregulin (EREG), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£196.00 - £1,021.60

Description

Recombinant Human Proepiregulin (EREG), partial | CSB-EP007779HU | Cusabio

Alternative Name(s): Epiregulin Short name: EPR

Gene Names: EREG

Research Areas: Cancer

Organism: Homo sapiens (Human)

AA Sequence: VAQVSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFLTVHQPLSKEYV

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 60-119aa

Sequence Info: Extracellular Domain

MW: 22.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Ligand of the EGF receptor/EGFR and ERBB4. May be a mediator of localized cell proliferation. As a mitogen it may stimulate cell proliferation and/or angiogenesis.

Reference: "Distribution of mRNA for human epiregulin, a differentially expressed member of the epidermal growth factor family."Toyoda H., Komurasaki T., Uchida D., Morimoto S.Biochem. J. 326:69-75(1997)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Ligand of the EGF receptor/EGFR and ERBB4. Stimulates EGFR and ERBB4 tyrosine phosphorylation

Involvement in disease:

Subcellular Location: Epiregulin: Secreted, extracellular space, SUBCELLULAR LOCATION: Proepiregulin: Cell membrane, Single-pass type I membrane protein

Protein Families:

Tissue Specificity: In normal adults, expressed predominantly in the placenta and peripheral blood leukocytes. High levels were detected in carcinomas of the bladder, lung, kidney and colon.

Paythway: ErbBsignalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O14944

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose