Recombinant Human Probetacellulin [Cleaved into: Betacellulin protein (BTC) | CSB-EP002853HU

(No reviews yet) Write a Review
SKU:
CSB-EP002853HU
Availability:
13 - 23 Working Days
  • Recombinant Human Probetacellulin [Cleaved into: Betacellulin protein (BTC)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$294.00 - $1,532.40

Description

Recombinant Human Probetacellulin [Cleaved into: Betacellulin protein (BTC) | CSB-EP002853HU | Cusabio

Alternative Name(s): BTCProbetacellulin [Cleaved into: Betacellulin; BTC)]

Gene Names: BTC

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFYLRGDRGQILVICLIAVMVVFIILVIGVCTCCHPLRKRRKRKKKEEEMETLGKDITPINEDIEETNIA

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 32-178aa

Sequence Info: Full Length of Mature Protein

MW: 43.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Growth factor that binds to EGFR, ERBB4 and other EGF receptor family mbers. Potent mitogen for retinal pigment epithelial cells and vascular smooth muscle cells.

Reference: Solution structure of betacellulin, a new member of EGF-family ligands.Miura K., Doura H., Aizawa T., Tada H., Seno M., Yamada H., Kawano K.Biochem. Biophys. Res. Commun. 294:1040-1046(2002)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Growth factor that binds to EGFR, ERBB4 and other EGF receptor family members. Potent mitogen for retinal pigment epithelial cells and vascular smooth muscle cells.

Involvement in disease:

Subcellular Location: Betacellulin: Secreted, extracellular space, SUBCELLULAR LOCATION: Probetacellulin: Cell membrane, Single-pass type I membrane protein

Protein Families:

Tissue Specificity: Synthesized in several tissues and tumor cells. Predominantly expressed in pancreas and small intestine.

Paythway: ErbBsignalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P35070

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose