Recombinant Human Pro-epidermal growth factor (EGF), partial (Active) | CSB-AP003711HU

Recombinant Human Pro-epidermal growth factor (EGF) ,partial (Active) | CSB-AP003711HU | Cusabio

Protein Description: Partial

Alternative Name (s) : Pro-Epidermal Growth Factor; EGF; Epidermal Growth Factor; Urogastrone

Gene Names: EGF

Research Areas: Signal Transduction

Species: Homo sapiens (Human)

Source: E.coli

Tag Info: Tag-Free

Expression Region: 971-1023aa

Sequence Info: NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR

Biological Activity: The ED50 as determined by the dose-dependent proliferation of murine BALB/c 3T3 cells is typically 0.1-0.5 ng/ml

MW: 6.2 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/µg as determined by LAL method.

Relevance: Epidermal growth factor (EGF) is a small 53 amino acid residue long protein that contains three disulfide bridges. It is a small mitogenic protein that is thought to be involved in mechanisms such as normal cell growth, oncogenesis, and wound healing. EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. This protein shows both strong sequential and functional homology with human type-alpha transforming growth factor (hTGF alpha) , which is a competitor for EGF receptor sites.

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function: EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. Magnesiotropic hormone that stimulates magnesium reabsorption in the renal distal convoluted tubule via engagement of EGFR and activation of the magnesium channel TRPM6. Can induce neurite outgrowth in motoneurons of the pond snail Lymnaea stagnalis in vitro

Involvement in disease: Hypomagnesemia 4 (HOMG4)

Subcellular Location: Membrane, Single-pass type I membrane protein

Protein Families:

Tissue Specificity: Expressed in kidney, salivary gland, cerebrum and prostate.

Paythway: ErbBsignalingpathway

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm Filtered 20 mM Tris-HCl, 200 mM NaCl, pH 8.0

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P01133

Uniprot Entry Name:

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM