Recombinant Human Prefoldin subunit 5 (PFDN5) | CSB-RP014144h

(No reviews yet) Write a Review
SKU:
CSB-RP014144h
Availability:
13 - 23 Working Days
  • Recombinant Human Prefoldin subunit 5 (PFDN5)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$294.00 - $1,532.40

Description

Recombinant Human Prefoldin subunit 5 (PFDN5) | CSB-RP014144h | Cusabio

Alternative Name(s): C-Myc-binding protein Mm-1Myc modulator 1

Gene Names: PFDN5

Research Areas: Epigenetics and Nuclear Signaling

Organism: Homo sapiens (Human)

AA Sequence: AQSINITELNLPQLEMLKNQLDQEVEFLSTSIAQLKVVQTKYVEAKDCLNVLNKSNEGKELLVPLTSSMYVPGKLHDVEHVLIDVGTGYYVEKTAEDAKDFFKRKIDFLTKQMEKIQPALQEKHAMKQAVMEMMSQKIQQLTALGAAQATAKA

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 2-154aa

Sequence Info: Full Length of Mature Protein

MW: 44.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins. Represses the transcriptional activity of MYC.

Reference: MM-1, a novel c-Myc-associating protein that represses transcriptional activity of c-Myc.Mori K., Maeda Y., Kitaura H., Taira T., Iguchi-Ariga S.M., Ariga H.J. Biol. Chem. 273:29794-29800(1998)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins. Represses the transcriptional activity of MYC.

Involvement in disease:

Subcellular Location: Isoform 1: Nucleus, SUBCELLULAR LOCATION: Isoform 2: Cytoplasm, SUBCELLULAR LOCATION: Isoform 3: Nucleus

Protein Families: Prefoldin subunit alpha family

Tissue Specificity: Highly expressed in pancreas and skeletal muscle and moderately in other tissues.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q99471

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose