Recombinant Human Poliovirus receptor (PVR), partial | CSB-EP019093HU

Recombinant Human Poliovirus receptor (PVR), partial | CSB-EP019093HU | Cusabio

Alternative Name(s): Nectin-like protein 5 Short name: NECL-5 CD_antigen: CD155

Gene Names: PVR

Research Areas: Microbiology

Organism: Homo sapiens (Human)

AA Sequence: WPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIRPVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGISRN

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 21-343aa

Sequence Info: Extracellular Domain

MW: 51.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Mediates NK cell adhesion and triggers NK cell effector functions. Binds two different NK cell receptors: CD96 and CD226. These interactions accumulates at the cell-cell contact site, leading to the formation of a mature immunological synapse between NK cell and target cell. This may trigger adhesion and secretion of lytic granules and IFN-gamma and activate cytoxicity of activated NK cells. May also promote NK cell-target cell modular exchange, and PVR transfer to the NK cell. This transfer is more important in some tumor cells expressing a lot of PVR, and may trigger fratricide NK cell activation, providing tumors with a mechanism of immunoevasion. Plays a role in mediating tumor cell invasion and migration.

Reference: "CD155/PVR plays a key role in cell motility during tumor cell invasion and migration."Sloan K.E., Eustace B.K., Stewart J.K., Zehetmeier C., Torella C., Simeone M., Roy J.E., Unger C., Louis D.N., Ilag L.L., Jay D.G.BMC Cancer 4:73-73(2004).

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Mediates NK cell adhesion and triggers NK cell effector functions. Binds two different NK cell receptors

Involvement in disease:

Subcellular Location: Isoform Alpha: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform Delta: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform Beta: Secreted, SUBCELLULAR LOCATION: Isoform Gamma: Secreted

Protein Families: Nectin family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P15151

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM