Cusabio Human Recombinants
Recombinant Human Platelet glycoprotein Ib alpha chain (GP1BA), partial | CSB-EP009685HU1
- SKU:
- CSB-EP009685HU1
- Availability:
- 13 - 23 Working Days
Description
Recombinant Human Platelet glycoprotein Ib alpha chain (GP1BA), partial | CSB-EP009685HU1 | Cusabio
Alternative Name(s): Antigen CD42b-alpha CD_antigen: CD42b
Gene Names: GP1BA
Research Areas: Immunology
Organism: Homo sapiens (Human)
AA Sequence: SWVGHVKPQALDSGQGAALTTATQTTHLELQRGRQVTVPRAWLLFLRGSLPTFRSSLFLWVRPNGRVGPLVAGRRPSALSQGRGQDLLSTVSIRYSGHSL
Source: E.coli
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region: 553-652aa
Sequence Info: Partial
MW: 15.9 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Relevance: GP-Ib, a surface membrane protein of platelets, participates in the formation of platelet plugs by binding to the A1 domain of vWF, which is already bound to the subendothelium.
Reference: "Identification of a novel point mutation in platelet glycoprotein Ibalpha, Gly to Ser at residue 233, in a Japanese family with platelet-type von Willebrand disease." Matsubara Y., Murata M., Sugita K., Ikeda Y. J. Thromb. Haemost. 1:2198-2205(2003)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: GP-Ib, a surface membrane protein of platelets, participates in the formation of platelet plugs by binding to the A1 domain of vWF, which is already bound to the subendothelium.
Involvement in disease: Non-arteritic anterior ischemic optic neuropathy (NAION); Bernard-Soulier syndrome (BSS); Bernard-Soulier syndrome A2, autosomal dominant (BSSA2); Pseudo-von Willebrand disease (VWDP)
Subcellular Location: Membrane, Single-pass type I membrane protein
Protein Families:
Tissue Specificity:
Paythway: Hematopoieticcelllineage
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P07359
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM