Cusabio Human Recombinants
Recombinant Human Platelet-derived growth factor subunit B (PDGFB) | CSB-EP017709HU
- SKU:
- CSB-EP017709HU
- Availability:
- 13 - 23 Working Days
Description
Recombinant Human Platelet-derived growth factor subunit B (PDGFB) | CSB-EP017709HU | Cusabio
Alternative Name(s): PDGF-2 (Platelet-derived growth factor B chain) (Platelet-derived growth factor beta polypeptide) (Proto-oncogene c-Sis) (INN: Becaplermin) (PDGF subunit B) (PDGF2) (SIS)
Gene Names: PDGFB
Research Areas: Cancer
Organism: Homo sapiens (Human)
AA Sequence: SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
Expression Region: 82-190aa
Sequence Info: Partial
MW: 28.3
Purity: Greater than 85% as determined by SDS-PAGE.
Relevance: Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin. Required for normal proliferation and recruitment of pericytes and vascular smooth muscle cells in the central nervous system, skin, lung, heart and placenta. Required for normal blood vessel development, and for normal development of kidney glomeruli. Plays an important role in wound healing. Signaling is modulated by the formation of heterodimers with PDGFA.
Reference: "Oncogenic potential of the human platelet-derived growth factor transcriptional unit." Rao C.D., Igarashi H., Pech M.W., Robbins K.C., Aaronson S.A. Cold Spring Harb. Symp. Quant. Biol. 51:959-966(1986)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P01127
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A