Recombinant Human Platelet-derived growth factor subunit B (PDGFB) (Active) | CSB-AP003821HU

Recombinant Human Platelet-derived growth factor subunit B (PDGFB) (Active) | CSB-AP003821HU | Cusabio

Protein Description: Full Length of Mature Protein

Alternative Name (s) : Platelet-Derived Growth Factor Subunit B; PDGF Subunit B; PDGF-2; Platelet-Derived Growth Factor B Chain; Platelet-Derived Growth Factor Beta Polypeptide; Proto-Oncogene c-Sis; Becaplermin; PDGFB; PDGF2; SIS

Gene Names: PDGFB

Research Areas: Cancer

Species: Homo sapiens (Human)

Source: E.coli

Tag Info: Tag-Free

Expression Region: 82-190aa

Sequence Info: SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT

Biological Activity: The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is less than 15-60 ng/mL.

MW: 12.42 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/µg as determined by LAL method.

Relevance: Platelet-Derived Growth Factor Subunit B (PDGFB) belongs to the PDGF/VEGF growth factor family. Platelet-derived growth factor is a potent mitogen for cells of mesenchymal origin. PDGFB can exist either as a homodimer (PDGF-BB) or as a heterodimer with the platelet-derived growth factor alpha polypeptide (PDGF-AB) , where the dimers are connected by disulfide bonds. Mutations in this gene are associated with meningioma.Binding of PDGFB to its receptor elicits a variety of cellular responses. In addition, PDGFB is released by platelets upon wounding and plays an important role in stimulating adjacent cells to grow and thereby heals the wound.

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function: Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin

Involvement in disease: Basal ganglia calcification, idiopathic, 5 (IBGC5)

Subcellular Location: Secreted

Protein Families: PDGF/VEGF growth factor family

Tissue Specificity: Expressed at high levels in the heart, brain (sustantia nigra) , placenta and fetal kidney. Expressed at moderate levels in the brain (hippocampus) , skeletal muscle, kidney and lung.

Paythway: Jak-STATsignalingpathway

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered solution of 20mM NaAc-HAc, pH 4.5.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P01127

Uniprot Entry Name:

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM